PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G022800.1
Common NamePHAVU_008G022800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CO-like
Protein Properties Length: 360aa    MW: 39608.9 Da    PI: 6.1888
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G022800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.42.2e-061252439
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.....Htv 39
                        r+C+++ + + + fC+  + +lC +C    H+      H++
  Phvul.008G022800.1 12 RTCDTCRSAPSTVFCRAHNAYLCSSCDGRVHHTsssswHER 52
                        79*************************99974456677765 PP

2zf-B_box28.72.6e-095398342
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                         ++C+ +e+ ++ + C+ +   lC +C   +H+       H +vp+
  Phvul.008G022800.1 53 VWVCEACERAPAAFLCKADAASLCSSCDADIHSAnplasrHHRVPI 98
                        689*****************************66899999877775 PP

3CCT70.54.3e-24290333144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Phvul.008G022800.1 290 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 333
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.968955IPR000315B-box-type zinc finger
SMARTSM003360.12948IPR000315B-box-type zinc finger
CDDcd000215.64E-51255No hitNo description
PROSITE profilePS5011910.9785198IPR000315B-box-type zinc finger
SMARTSM003361.9E-135198IPR000315B-box-type zinc finger
PfamPF006432.4E-75298IPR000315B-box-type zinc finger
CDDcd000215.91E-85498No hitNo description
PROSITE profilePS5101716.648290332IPR010402CCT domain
PfamPF062036.8E-18290332IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MLEGEPAGTW ARTCDTCRSA PSTVFCRAHN AYLCSSCDGR VHHTSSSSWH ERVWVCEACE  60
RAPAAFLCKA DAASLCSSCD ADIHSANPLA SRHHRVPILP IAAGHHSHVE IDVADDDDAA  120
DVDDDDETAS WLLLNPVKTG TVPNSNNNGF LYSGEVDEYL DLVDNCNSCG DNNHFAATTT  180
TTATTADHYT QHHHFDGVSQ KSYAGDSVVP VQQHQHFQLG LEFENSKPAF SYNGSISQSI  240
SVSTLDIGVV PESPMRDVSI SHTRPPKGTI DLFSGPPIQM MPSHFSPMDR EARVLRYREK  300
KKTRKFEKTI RYASRKAYAE TRPRIKGRFA KRTDVEAEVD QMFSTTLITE VGYGLVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139358.10.0hypothetical protein PHAVU_008G022800g
SwissprotQ965021e-122COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLV7B0D70.0V7B0D7_PHAVU; Uncharacterized protein
STRINGGLYMA18G51320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.13e-95CONSTANS-like 2